DDX47 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57295

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDX47 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) The peptide sequence was selected from the C terminal of DDX47. Peptide sequence AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DDX47 Antibody - BSA Free

Western Blot: DDX47 Antibody [NBP1-57295]

Western Blot: DDX47 Antibody [NBP1-57295]

Western Blot: DDX47 Antibody [NBP1-57295] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-57295]

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-57295]

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-57295] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for DDX47 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX47

DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Alternate Names

DEAD (Asp-Glu-Ala-Asp) box polypeptide 47, DEAD box polypeptide 47, DEAD box protein 47, DKFZp564O176, E4-DBP, E4-DEAD box protein, EC 3.6.1, EC 3.6.4.13, FLJ30012, HQ0256, MSTP162, probable ATP-dependent RNA helicase DDX47, RRP3

Gene Symbol

DDX47

UniProt

Q9H0S4 (Human)

Additional DDX47 Products

Product Documents for DDX47 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDX47 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX47 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDX47 Antibody - BSA Free and earn rewards!

Have you used DDX47 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies