Decorin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57923

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Canine

Cited:

Canine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Decorin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DCN(decorin) The peptide sequence was selected from the N terminal of DCN. Peptide sequence IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 26341258).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Decorin Antibody - BSA Free

Western Blot: Decorin Antibody [NBP1-57923]

Western Blot: Decorin Antibody [NBP1-57923]

Western Blot: Decorin Antibody [NBP1-57923] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta
Immunohistochemistry: Decorin Antibody [NBP1-57923]

Immunohistochemistry: Decorin Antibody [NBP1-57923]

Decorin-Antibody-Immunohistochemistry-NBP1-57923-img0010.jpg
Western Blot: Decorin Antibody [NBP1-57923]

Western Blot: Decorin Antibody [NBP1-57923]

Decorin-Antibody-Western-Blot-NBP1-57923-img0008.jpg
Immunocytochemistry/ Immunofluorescence: Decorin Antibody [NBP1-57923]

Immunocytochemistry/ Immunofluorescence: Decorin Antibody [NBP1-57923]

Immunocytochemistry/Immunofluorescence: Decorin Antibody [NBP1-57923] - Human periodontal ligament cells stained with rabbit anti-decorin 1:300 and goat anti-rabbit Alexa 488 1:500. Nuclei stained with DAPI. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923]

Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923]

Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-57923] - Human skin tissue at an antibody concentration of 4-8 ug/mL.
Decorin Antibody

Immunohistochemistry: Decorin Antibody [NBP1-57923] -

Immunohistochemistry: Decorin Antibody [NBP1-57923] - Comparative immunohistochemical analysis of non-chondrodystrophic (NCD) & chondrodystrophic (CD) canine nucleus pulposus (NP) expression & distribution of decorin, biglycan, fibromodulin, hyaluronan & proteoglycan link protein 1 (HAPLN1), & aggrecan. For all extracellular matrix (ECM) proteins, the NCD canine intervertebral disc NP reveals a cobweb appearance, demonstrating intense staining for all proteins located in the areas tightly between the cells. Immunostaining with decorin reveals diffuse intercellular staining with negative immunostaining within the large, physaliferous-appearing notochordal cells. This presentation is in contrast to the abundant staining of these proteins in every CD NP sample. Decorin, biglycan, & HAPLN1 reveal intense staining within the ECM, with abundant clusters of small numbers of cells present within the NP. Although the ECM staining is less intense than that for the other three proteins, fibromodulin & aggrecan immunostaining is present. Furthermore, the CD NP stained for aggrecan reveals intense pericellular immunostaining diffusely throughout the ECM that is much less cellular than the NCD NP staining. Safranin-O staining shows quite intense ECM staining in the CD NP, whereas the NCD sample demonstrates intense intercellular staining without large, acellular ECM areas rich in proteoglycan staining. The overall appearance of the CD NP bears a strong resemblance to a fibrocartilaginous phenotype that is distinctly different from the NCD canine NP Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26341258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Decorin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
This Decorin Antibody is validated for ICC/IF from a verified customer review.

Reviewed Applications

Read 1 review rated 4 using NBP1-57923 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Decorin

DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Alternate Names

DCN, DSPG2, PG-II, PGS2, SLRR1B

Gene Symbol

DCN

UniProt

P07585

Additional Decorin Products

Product Documents for Decorin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Decorin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Decorin Antibody - BSA Free

Customer Reviews for Decorin Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Decorin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Decorin Antibody
    Name: Catherine Heyward
    Application: Immunocytochemistry
    Sample Tested: Cell culture
    Species: Human
    Verified Customer | Posted 07/29/2021
    Human periodontal ligament cells stained with rabbit anti-decorin 1:300 and goat anti-rabbit Alexa 488 1:500. Nuclei stained with DAPI.
    Decorin Antibody - BSA Free NBP1-57923

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies