DEK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38834

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEI

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DEK Antibody - BSA Free

Western Blot: DEK Antibody [NBP2-38834]

Western Blot: DEK Antibody [NBP2-38834]

Western Blot: DEK Antibody [NBP2-38834] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DEK Antibody [NBP2-38834]

Immunocytochemistry/ Immunofluorescence: DEK Antibody [NBP2-38834]

Immunocytochemistry/Immunofluorescence: DEK Antibody [NBP2-38834] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus.
DEK Antibody

Western Blot: Rabbit Polyclonal DEK Antibody [NBP2-38834]

Western Blot: Rabbit Polyclonal DEK Antibody [NBP2-38834] - Antibody used to detect DEK protein in the liver lysates of DEK+/+ and DEK -/- mice by western blot at 1 ug/ml. DEK bands appeared at around 52 kDa. Image from a verified customer review.
DEK Antibody

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] -

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
DEK Antibody

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] -

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] -Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
DEK Antibody

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] -

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] - Staining of human rectum shows strong nuclear positivity in glandular cells.
DEK Antibody

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] -

Immunohistochemistry-Paraffin: DEK Antibody [NBP2-38834] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Applications for DEK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP2-38834 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEK

DEK is a chromatin-binding protein that may serve as an architectural protein at promoter or enhancer sites of particular genes and may be involved in the regulation of transcription and mRNA processing. DEK has been identified as an oncoprotein and an autoantigen.

Alternate Names

D6S231EDEK oncogene (DNA binding), DEK oncogene, protein DEK

Gene Symbol

DEK

UniProt

Additional DEK Products

Product Documents for DEK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DEK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DEK Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used DEK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • Antibody works
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Liver tissue
    Species: Mouse
    Verified Customer | Posted 11/27/2024
    DEK western blot
    I used this antibody to detect DEK protein in the liver lysates of DEK+/+ and DEK -/- mice by western blot at 1 ug/ml. DEK bands appeared at around 52 kDa.
    DEK Antibody - BSA Free NBP2-38834
    Bio-Techne Response
    This review reflects a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...