DNA Ligase IV Antibody - BSA Free
Novus Biologicals | Catalog # NB110-57379
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Cited:
Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DNA Ligase IV. Peptide Sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:32846126).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for DNA Ligase IV Antibody - BSA Free
Western Blot: DNA Ligase IV Antibody [NB110-57379]
Western Blot: DNA Ligase IV Antibody [NB110-57379] - HepG2 cell lysate.Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379]
Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379] - Immunohistochemical staining of human pancreatic tissue using NB110-57379 at a concentration of 5 ug/ml.Applications for DNA Ligase IV Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
4-8 ug/ml
Western Blot
1.0 ug/ml
Application Notes
Use in Knockdown Validated reported in scientific literature (PMID:32846126)
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DNA Ligase IV
Additional DNA Ligase IV Products
Product Documents for DNA Ligase IV Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DNA Ligase IV Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for DNA Ligase IV Antibody - BSA Free
Customer Reviews for DNA Ligase IV Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DNA Ligase IV Antibody - BSA Free and earn rewards!
Have you used DNA Ligase IV Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
View specific protocols for DNA Ligase IV Antibody - BSA Free (NB110-57379):
Western Blot protocol specific for DNA Ligase IV Antibody (NB110-57379):
To prepare total cell lysates, spin down cells and re-suspension the pellet in PBS to make the final concentration around 3 x 10^6 cells / ml. This is a convenient cell density for many cell lines, but adjustments may be necessary for cell types that differ substantially in size and protein content. Prepare cell extracts in appropriate non-reducing or reducing sample buffer. In some cases reducing agents may disrupt the conformation that is recognized by a monoclonal detection antibody. Mix the cell suspension with an equal volume of non-reducing 2X SDS gel sample buffer (6% SDS, 0.25 M Tris, pH 6.8, 10% glycerol, and bromophenyl blue) or reducing 2X SDS gel sample buffer [non-reducing buffer plus 20 mM dithithreitol (DTT)]. Sonicate the cells to fragment the DNA using 8-10 bursts of 2-3 seconds each.
1. Load cell extracts and separate proteins on a 12% SDS-PAGE gel.
2. Transfer the separated proteins onto an Immobilon P membrane (Millipore) and incubate the membrane for 1 hour at room temperature or overnight at 2-8 C in Blocking Solution (1 X PBS, pH 7.4 containing 5% dry milk).
3. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer (1X PBS with 0.1% NP40,).
4. Incubate the membrane for 2 hours at room temperature or overnight at 2-8 C in Blotting Buffer (1 X PBS, pH 7.4 containing 5% dry milk) containing NB110-57379 ( 1.25ug/ml).
5. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
6. Incubate the membrane at room temperature for 1 hour in Blotting Buffer containing an HRP conjugated anti-Rabbit IgG secondary antibody, diluted 1: 50,000 - 100,000.
7. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
8. Detect with chemiluminescence reagents.
To prepare total cell lysates, spin down cells and re-suspension the pellet in PBS to make the final concentration around 3 x 10^6 cells / ml. This is a convenient cell density for many cell lines, but adjustments may be necessary for cell types that differ substantially in size and protein content. Prepare cell extracts in appropriate non-reducing or reducing sample buffer. In some cases reducing agents may disrupt the conformation that is recognized by a monoclonal detection antibody. Mix the cell suspension with an equal volume of non-reducing 2X SDS gel sample buffer (6% SDS, 0.25 M Tris, pH 6.8, 10% glycerol, and bromophenyl blue) or reducing 2X SDS gel sample buffer [non-reducing buffer plus 20 mM dithithreitol (DTT)]. Sonicate the cells to fragment the DNA using 8-10 bursts of 2-3 seconds each.
1. Load cell extracts and separate proteins on a 12% SDS-PAGE gel.
2. Transfer the separated proteins onto an Immobilon P membrane (Millipore) and incubate the membrane for 1 hour at room temperature or overnight at 2-8 C in Blocking Solution (1 X PBS, pH 7.4 containing 5% dry milk).
3. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer (1X PBS with 0.1% NP40,).
4. Incubate the membrane for 2 hours at room temperature or overnight at 2-8 C in Blotting Buffer (1 X PBS, pH 7.4 containing 5% dry milk) containing NB110-57379 ( 1.25ug/ml).
5. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
6. Incubate the membrane at room temperature for 1 hour in Blotting Buffer containing an HRP conjugated anti-Rabbit IgG secondary antibody, diluted 1: 50,000 - 100,000.
7. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
8. Detect with chemiluminescence reagents.
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...