DNA Ligase IV Antibody - BSA Free

Novus Biologicals | Catalog # NB110-57379

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DNA Ligase IV. Peptide Sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32846126).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNA Ligase IV Antibody - BSA Free

Western Blot: DNA Ligase IV Antibody [NB110-57379]

Western Blot: DNA Ligase IV Antibody [NB110-57379]

Western Blot: DNA Ligase IV Antibody [NB110-57379] - HepG2 cell lysate.
Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379]

Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379]

Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379] - Immunohistochemical staining of human pancreatic tissue using NB110-57379 at a concentration of 5 ug/ml.

Applications for DNA Ligase IV Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml
Application Notes
Use in Knockdown Validated reported in scientific literature (PMID:32846126)

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNA Ligase IV

LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Long Name

DNA ligase 4

Alternate Names

LIG4

Entrez Gene IDs

3981 (Human)

Gene Symbol

LIG4

UniProt

Additional DNA Ligase IV Products

Product Documents for DNA Ligase IV Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNA Ligase IV Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DNA Ligase IV Antibody - BSA Free

Customer Reviews for DNA Ligase IV Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNA Ligase IV Antibody - BSA Free and earn rewards!

Have you used DNA Ligase IV Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

View specific protocols for DNA Ligase IV Antibody - BSA Free (NB110-57379):

Western Blot protocol specific for DNA Ligase IV Antibody (NB110-57379):

To prepare total cell lysates, spin down cells and re-suspension the pellet in PBS to make the final concentration around 3 x 10^6 cells / ml. This is a convenient cell density for many cell lines, but adjustments may be necessary for cell types that differ substantially in size and protein content. Prepare cell extracts in appropriate non-reducing or reducing sample buffer. In some cases reducing agents may disrupt the conformation that is recognized by a monoclonal detection antibody. Mix the cell suspension with an equal volume of non-reducing 2X SDS gel sample buffer (6% SDS, 0.25 M Tris, pH 6.8, 10% glycerol, and bromophenyl blue) or reducing 2X SDS gel sample buffer [non-reducing buffer plus 20 mM dithithreitol (DTT)]. Sonicate the cells to fragment the DNA using 8-10 bursts of 2-3 seconds each.

1. Load cell extracts and separate proteins on a 12% SDS-PAGE gel.
2. Transfer the separated proteins onto an Immobilon P membrane (Millipore) and incubate the membrane for 1 hour at room temperature or overnight at 2-8 C in Blocking Solution (1 X PBS, pH 7.4 containing 5% dry milk).
3. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer (1X PBS with 0.1% NP40,).
4. Incubate the membrane for 2 hours at room temperature or overnight at 2-8 C in Blotting Buffer (1 X PBS, pH 7.4 containing 5% dry milk) containing NB110-57379 ( 1.25ug/ml).
5. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
6. Incubate the membrane at room temperature for 1 hour in Blotting Buffer containing an HRP conjugated anti-Rabbit IgG secondary antibody, diluted 1: 50,000 - 100,000.
7. Wash the membrane at room temperature for 30 minutes with 5 changes of Wash Buffer.
8. Detect with chemiluminescence reagents.

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...