DNA Polymerase beta Antibody (6M8I5)
Novus Biologicals | Catalog # NBP3-16127
Recombinant Monoclonal Antibody
![Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]](https://resources.rndsystems.com/images/products/DNA-Polymerase-beta-Antibody-6M8I5-Western-Blot-NBP3-16127-img0003.jpg "Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6M8I5 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for DNA Polymerase beta Antibody (6M8I5)
Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]
Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Western blot analysis of extracts of various cell lines, using DNA Polymerase beta Rabbit mAb (NBP3-16127) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.![Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]](https://resources.rndsystems.com/images/products/DNA-Polymerase-beta-Antibody-6M8I5-Immunohistochemistry-Paraffin-NBP3-16127-img0002.jpg "Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]")
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Immunohistochemistry of paraffin-embedded mouse testis using DNA Polymerase beta Rabbit mAb (NBP3-16127) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]](https://resources.rndsystems.com/images/products/DNA-Polymerase-beta-Antibody-6M8I5-Immunohistochemistry-Paraffin-NBP3-16127-img0001.jpg "Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]")
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Immunohistochemistry of paraffin-embedded rat testis using DNA Polymerase beta Rabbit mAb (NBP3-16127) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.Applications for DNA Polymerase beta Antibody (6M8I5)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: DNA Polymerase beta
Alternate Names
POLB
Gene Symbol
POLB
Additional DNA Polymerase beta Products
Product Documents for DNA Polymerase beta Antibody (6M8I5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DNA Polymerase beta Antibody (6M8I5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for DNA Polymerase beta Antibody (6M8I5)
There are currently no reviews for this product. Be the first to review DNA Polymerase beta Antibody (6M8I5) and earn rewards!
Have you used DNA Polymerase beta Antibody (6M8I5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...