DNAJB12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59444

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNAJB12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DNAJB12(DnaJ (Hsp40) homolog, subfamily B, member 12) The peptide sequence was selected from the middle region of DNAJB12. Peptide sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNAJB12 Antibody - BSA Free

Western Blot: DNAJB12 Antibody [NBP1-59444]

Western Blot: DNAJB12 Antibody [NBP1-59444]

Western Blot: DNAJB12 Antibody [NBP1-59444] - Human Spleen lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: DNAJB12 Antibody [NBP1-59444]

Immunohistochemistry: DNAJB12 Antibody [NBP1-59444]

Immunohistochemistry: DNAJB12 Antibody [NBP1-59444] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for DNAJB12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB12

DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.

Alternate Names

DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027

Gene Symbol

DNAJB12

UniProt

Q9NXW2 (Human)

Additional DNAJB12 Products

Product Documents for DNAJB12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJB12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB12 Antibody - BSA Free and earn rewards!

Have you used DNAJB12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies