DNAJB12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17700

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNAJB12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJB12 Antibody - BSA Free

Western Blot: DNAJB12 Antibody [NBP3-17700]

Western Blot: DNAJB12 Antibody [NBP3-17700]

Western Blot: DNAJB12 Antibody [NBP3-17700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: DNAJB12 Antibody [NBP3-17700]

Immunocytochemistry/ Immunofluorescence: DNAJB12 Antibody [NBP3-17700]

Immunocytochemistry/Immunofluorescence: DNAJB12 Antibody [NBP3-17700] - Staining of human cell line HaCaT shows localization to nuclear membrane & endoplasmic reticulum.

Applications for DNAJB12 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB12

DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.

Alternate Names

DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027

Gene Symbol

DNAJB12

Additional DNAJB12 Products

Product Documents for DNAJB12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJB12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB12 Antibody - BSA Free and earn rewards!

Have you used DNAJB12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies