DNAJC15 Antibody (7D7X7)

Name: DNAJC15 Antibody (7D7X7)
Brand: Novus Biologicals
SKU: NBP3-16488
Price: 169 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16488

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7D7X7 expressed in HEK293

View all DNAJC15 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4). ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJC15 Antibody (7D7X7)

Western Blot: DNAJC15 Antibody (7D7X7) [NBP3-16488]

Western Blot: DNAJC15 Antibody (7D7X7) [NBP3-16488] - Analysis of extracts of various cell lines, using DNAJC15 Rabbit mAb (NBP3-16488) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: DNAJC15 Antibody (7D7X7) [NBP3-16488]

Immunocytochemistry/Immunofluorescence: DNAJC15 Antibody (7D7X7) [NBP3-16488] - Immunofluorescence analysis of NIH-3T3 cells using DNAJC15 Rabbit mAb (NBP3-16488) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for DNAJC15 Antibody (7D7X7)

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNAJC15

DNAJD1( AAH10910, 1 a.a. - 151 a.a.) full-length recombinant protein with GST.

Alternate Names

Cell growth-inhibiting gene 22 protein, DnaJ (Hsp40) homolog, subfamily C, member 15, DnaJ (Hsp40) homolog, subfamily D, member 1, DNAJ domain-containing, dnaJ homolog subfamily C member 15, DNAJD1, MCJHSD18, Methylation-controlled J protein

Gene Symbol

DNAJC15

Additional DNAJC15 Products

Product Documents for DNAJC15 Antibody (7D7X7)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNAJC15 Antibody (7D7X7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJC15 Antibody (7D7X7)

There are currently no reviews for this product. Be the first to review DNAJC15 Antibody (7D7X7) and earn rewards!

Have you used DNAJC15 Antibody (7D7X7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image