DNALI1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56390

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DNALI1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DNALI1(dynein, axonemal, light intermediate chain 1) The peptide sequence was selected from the N terminal of DNALI1. Peptide sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNALI1 Antibody - BSA Free

Western Blot: DNALI1 Antibody [NBP1-56390]

Western Blot: DNALI1 Antibody [NBP1-56390]

Western Blot: DNALI1 Antibody [NBP1-56390] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: DNALI1 Antibody [NBP1-56390]

Immunohistochemistry: DNALI1 Antibody [NBP1-56390]

Immunohistochemistry: DNALI1 Antibody [NBP1-56390] - Application: IHC, Human nasal epithelial cells, antibody dilution: 1:1000 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 Secondary Antibody dilution: 1:1000.

Applications for DNALI1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNALI1

DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Alternate Names

dJ423B22.5, dynein, axonemal, light intermediate chain 1, dynein, axonemal, light intermediate polypeptide 1, hp28axonemal dynein light intermediate polypeptide 1, Inner dynein arm light chain, axonemal, inner dynein arm, homolog of clamydomonas, P28dJ423B22.5 (axonemal dynein light chain (hp28))

Gene Symbol

DNALI1

Additional DNALI1 Products

Product Documents for DNALI1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNALI1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNALI1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNALI1 Antibody - BSA Free and earn rewards!

Have you used DNALI1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies