DNMT3A Antibody (7L9O3)

Novus Biologicals | Catalog # NBP3-15844

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7L9O3 expressed in HEK293
View all DNMT3A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1). GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNMT3A Antibody (7L9O3)

Immunoprecipitation: DNMT3A Antibody (7L9O3) [NBP3-15844]

Immunoprecipitation: DNMT3A Antibody (7L9O3) [NBP3-15844]

Immunoprecipitation: DNMT3A Antibody (7L9O3) [NBP3-15844] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug DNMT3A antibody (NBP3-15844). Western blot was performed from the immunoprecipitate using DNMT3A antibody (NBP3-15844) at a dilition of 1:1000.
DNMT3A Antibody (7L9O3)

Western Blot: DNMT3A Antibody (7L9O3) [NBP3-15844] -

Western Blot: DNMT3A Antibody (7L9O3) [NBP3-15844] - Analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells, using [KO Validated] DNMT3A at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.
DNMT3A Antibody (7L9O3)

Western Blot: DNMT3A Antibody (7L9O3) [NBP3-15844] -

Western Blot: DNMT3A Antibody (7L9O3) [NBP3-15844] - Analysis of lysates from Mouse Thymus, using DNMT3A Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.
DNMT3A Antibody (7L9O3)

Western Blot: DNMT3A Antibody (7L9O3) [DNMT3A] -

Western Blot: DNMT3A Antibody (7L9O3) [DNMT3A] - Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells using [KO Validated] DNMT3A at 1:500 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
DNMT3A Antibody (7L9O3)

Western Blot: DNMT3A Antibody (7L9O3) [DNMT3A] -

Western Blot: DNMT3A Antibody (7L9O3) [DNMT3A] - Western blot analysis of lysates from Mouse Thymus using DNMT3A Rabbit mAb at 1:500 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for DNMT3A Antibody (7L9O3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNMT3A

Methylation of cytosine residues is essential for mammalian development by regulating gene expression, gene silencing and genomic imprinting (1). This process is controlled by the enzyme DNA (cytosine-5)-methyltransferase 3A (DNMt3a), which is encoded by the DNMT3A gene and has a predicted molecular weight of 102 kDa. DNA methyltransferases including DNMt3a are involved in de novo cytosine methylation and maintenance of embryonic and somatic cells through the transfer of methyl groups to specific CpG structures in DNA (2). Somatic mutations in DNMT3A are responsible for cytogenetically normal acute myeloid leukemia (CN-AML). Hypermethylation of CpG islands in tumor suppressor genes or hypomethylation of bulk genomic DNA are linked with cancer (3,4). Mutations in the DNMT3A gene have also been found to cause DNMT3A overgrowth syndrome and myelodysplastic syndromes.

References

1. Thakur, A., Mackin, S. J., Irwin, R. E., O'Neill, K. M., Pollin, G., & Walsh, C. (2016). Widespread recovery of methylation at gametic imprints in hypomethylated mouse stem cells following rescue with DNMT3A2. Epigenetics Chromatin, 9, 53. doi:10.1186/s13072-016-0104-2

2. Ravichandran, M., Lei, R., Tang, Q., Zhao, Y., Lee, J., Ma, L.,... Dawlaty, M. M. (2019). Rinf Regulates Pluripotency Network Genes and Tet Enzymes in Embryonic Stem Cells. Cell Rep, 28(8), 1993-2003.e1995. doi:10.1016/j.celrep.2019.07.080

3. Pang, Y., Liu, J., Li, X., Xiao, G., Wang, H., Yang, G.,... Ren, H. (2018). MYC and DNMT3A-mediated DNA methylation represses microRNA-200b in triple negative breast cancer. J Cell Mol Med, 22(12), 6262-6274. doi:10.1111/jcmm.13916

4. Xia, L., Huang, W., Bellani, M., Seidman, M. M., Wu, K., Fan, D.,... Baylin, S. B. (2017). CHD4 Has Oncogenic Functions in Initiating and Maintaining Epigenetic Suppression of Multiple Tumor Suppressor Genes. Cancer Cell, 31(5), 653-668.e657. doi:10.1016/j.ccell.2017.04.005

Long Name

DNA [Cytosine-5-]-Methyltransferase 3A

Alternate Names

DNA (cytosine-5-)-methyltransferase 3 alpha, DNA (cytosine-5)-methyltransferase 3A, DNA cytosine methyltransferase 3A2, DNA Methyltransferase 3 Alpha, DNA methyltransferase HsaIIIA, DNA MTase HsaIIIA, Dnmt3a, DNMT3A2, EC 2.1.1.37, M.HsaIIIA, TBRS

Gene Symbol

DNMT3A

Additional DNMT3A Products

Product Documents for DNMT3A Antibody (7L9O3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DNMT3A Antibody (7L9O3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Adult Neurogenesis
Epigenetics

Customer Reviews for DNMT3A Antibody (7L9O3)

There are currently no reviews for this product. Be the first to review DNMT3A Antibody (7L9O3) and earn rewards!

Have you used DNMT3A Antibody (7L9O3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies