DR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47480

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining in human testis and liver tissues using anti-DR1 antibody. Corresponding DR1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human cerebral cortex, gallbladder, liver and testis using Anti-DR1 antibody NBP2-47480 (A) shows similar protein distribution across tissues to independent antibody NBP2-48979 (B).
Western Blot: DR1 Antibody [NBP2-47480]

Western Blot: DR1 Antibody [NBP2-47480]

Western Blot: DR1 Antibody [NBP2-47480] - Analysis in control (vector only transfected HEK293T lysate) and DR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: DR1 Antibody [NBP2-47480]

Immunocytochemistry/ Immunofluorescence: DR1 Antibody [NBP2-47480]

Immunocytochemistry/Immunofluorescence: DR1 Antibody [NBP2-47480] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480]

Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human gallbladder.
DR1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: DR1 Antibody - BSA Free [NBP2-47480]

Chromatin Immunoprecipitation-exo-Seq: DR1 Antibody - BSA Free [NBP2-47480]

ChIP-Exo-Seq composite graph for Anti-DR1 (NBP2-47480) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for DR1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DR1

DR1 encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription. [provided by RefSeq]

Alternate Names

Down-regulator of transcription 1, down-regulator of transcription 1, TBP-binding (negative cofactor 2), NC2, NC2-BETA, Negative cofactor 2-beta, protein Dr1, TATA-binding protein-associated phosphoprotein

Gene Symbol

DR1

Additional DR1 Products

Product Documents for DR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DR1 Antibody - BSA Free and earn rewards!

Have you used DR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...