DUSP15 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92313

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human DUSP15 (NP_542178.2). PGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DUSP15 Antibody - Azide and BSA Free

Western Blot: DUSP15 AntibodyAzide and BSA Free [NBP2-92313]

Western Blot: DUSP15 AntibodyAzide and BSA Free [NBP2-92313]

Western Blot: DUSP15 Antibody [NBP2-92313] - Analysis of extracts of various cell lines, using DUSP15 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
DUSP15 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: DUSP15 Antibody - Azide and BSA Free [NBP2-92313] -

Immunocytochemistry/ Immunofluorescence: DUSP15 Antibody - Azide and BSA Free [NBP2-92313] - Immunofluorescence analysis of L929 cells using DUSP15 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for DUSP15 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DUSP15

DUSP15 is encoded by this gene belongs to the non-receptor class of the protein-tyrosine phosphatase family. The encoded protein has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

dual specificity phosphatase 15

Gene Symbol

DUSP15

Additional DUSP15 Products

Product Documents for DUSP15 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DUSP15 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for DUSP15 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review DUSP15 Antibody - Azide and BSA Free and earn rewards!

Have you used DUSP15 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...