DUSP27/DUPD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84040

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DUSP27/DUPD1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRL

Reactivity Notes

Rat reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DUSP27/DUPD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody [NBP1-84040]

Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody [NBP1-84040]

Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody [NBP1-84040] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
DUSP27/DUPD1 Antibody

Western Blot: DUSP27/DUPD1 Antibody [NBP1-84040] -

Western Blot: DUSP27/DUPD1 Antibody [NBP1-84040] - Rat soleus muscle loaded at 10, 20, 30 and 40 µg protein in lanes 2-5, and lanes 6-9. DUSP29 ab was diluted in 5% BSA/TBST or 3% milk/TBST and incubated overnight at 4°C. Secondary ab in 5%milk/TBST at 1:20K for 1 hour at RT. Image from verified customer review.
DUSP27/DUPD1 Antibody - BSA Free Western Blot: DUSP27/DUPD1 Antibody - BSA Free [NBP1-84040]

Western Blot: DUSP27/DUPD1 Antibody - BSA Free [NBP1-84040]

Analysis in control (vector only transfected HEK293T lysate) and DUPD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for DUSP27/DUPD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP1-84040 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP27/DUPD1

Alternate Names

atypical dual-specific protein phosphatase, Dual specificity phosphatase 27, dual specificity phosphatase and pro isomerase domain containing 1, DUSP27dual specificity phosphatase DUPD1, EC 3.1.3.16, EC 3.1.3.48, FMDSP

Gene Symbol

DUPD1

Additional DUSP27/DUPD1 Products

Product Documents for DUSP27/DUPD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DUSP27/DUPD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for DUSP27/DUPD1 Antibody - BSA Free

Customer Reviews for DUSP27/DUPD1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used DUSP27/DUPD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • DUSP27/DUPD1 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Rat skeletal muscle tissue
    Species: Rat
    Verified Customer | Posted 03/10/2023
    Rat soleus muscle loaded at 10, 20, 30 and 40 µg protein in lanes 2-5, and lanes 6-9. DUSP29 ab was diluted in 5% BSA/TBST or 3% milk/TBST and incubated overnight at 4°C. Secondary ab in 5%milk/TBST at 1:20K for 1 hour at RT.
    DUSP27/DUPD1 Antibody - BSA Free NBP1-84040
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies