Dynamin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38480

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dynamin 2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 607-866 of human Dynamin 2 (NP_004936.2).

Sequence:
EDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Dynamin 2 Antibody - BSA Free

Dynamin 2 Antibody

Western Blot: Dynamin 2 Antibody [NBP3-38480] -

Western Blot: Dynamin 2 Antibody [NBP3-38480] - Western blot analysis of various lysates using Dynamin 2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
Dynamin 2 Antibody

Immunocytochemistry/ Immunofluorescence: Dynamin 2 Antibody [NBP3-38480] -

Immunocytochemistry/ Immunofluorescence: Dynamin 2 Antibody [NBP3-38480] - Immunofluorescence analysis of NIH-3T3 cells using Dynamin 2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Dynamin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dynamin 2

The dynamins are a family of 100 kDa GTPases transcribed from at least three separate genes. At least four mRNA splice variants for each dynamin have been described. Dynamins contain several conserved regions including the conserved, amino-terminal GTPase domain, a centrally located membrane-binding plekstrin homology domain (PHD), and a coiled-coil region located in front of a proline-rich domain (PRD). The PRD is thought to mediate interactions between dynamin and numerous other cellular proteins. Dynamin 1 is expressed exclusively in neurons, Dynamin 2 is ubiquitously expressed, and Dynamin 3 is thought to be restricted to expression in the brain, testis, heart, and lung. The dynamins participate in the cellular process of clathrin-mediated and fluid-phase endocytosis.

Long Name

Dynamin-2

Alternate Names

DNM2, DYN2

Gene Symbol

DNM2

Additional Dynamin 2 Products

Product Documents for Dynamin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dynamin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dynamin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dynamin 2 Antibody - BSA Free and earn rewards!

Have you used Dynamin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies