Dynein heavy chain Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38671

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Dynein heavy chain Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dynein heavy chain Antibody - BSA Free

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human bronchus shows strong positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining in human fallopian tube and prostate tissues using anti-DNAH9 antibody. Corresponding DNAH9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671]

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human prostate shows low expression as expected.

Applications for Dynein heavy chain Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dynein heavy chain

Dynein heavy chain 9, axonemal is a protein that has three isoforms, with lengths of 4486, 4410, and 798 amino acids and weights of approximately 512, 503, and 798 kDa respectively. Dynein heavy chain generates force at the minus end of the microtubules that make up cilia which occurs due to the use of ADP that dynein obtains through ATPase activity. Current research is being done on diseases and disorders linked to this protein including ciliary dyskinesia, Kartagener syndrome, bronchiectasis, and malaria. Dynein heavy chain has also been shown to have interactions with BCL6, DNAH1, DNAH17, DNAH2, and DNAH3 in pathways such as the cytoplasmic microtubules pathway.

Alternate Names

axonemal, heavy polypeptide 9, ciliary dynein heavy chain 9, DNAH9 variant protein, DYH9, dynein heavy chain 9, axonemal, dynein, axonemal, heavy chain 9, HL20

Gene Symbol

DNAH9

UniProt

Q9NYC9 (Human)

Additional Dynein heavy chain Products

Product Documents for Dynein heavy chain Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dynein heavy chain Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dynein heavy chain Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dynein heavy chain Antibody - BSA Free and earn rewards!

Have you used Dynein heavy chain Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies