Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-92214

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Dynein light chain 2a cytoplasmic Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1). MDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free [NBP2-92214]

Immunohistochemistry-Paraffin: Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free [NBP2-92214]

Immunohistochemistry-Paraffin: Dynein light chain 2a cytoplasmic Antibody [NBP2-92214] - Human thyroid cancer using DYNLRB1 Rabbit pAb at dilution of 1:100 (40x lens).
Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Western Blot: Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free [NBP2-92214] -

Western Blot: Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free [NBP2-92214] - Western blot analysis of various lysates using Dynein light chain 2a cytoplasmic Rabbit pAb at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dynein light chain 2a cytoplasmic

The Dynein light chain gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable ofbinding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas,suggesting that this gen

Alternate Names

BITH, Bithoraxoid-like protein, DNCL2Acytoplasmic dynein light chain 2A, DNLC2ABLP, Dynein light chain 2A, cytoplasmic, dynein light chain roadblock-type 1, dynein, cytoplasmic, light polypeptide 2A, dynein, light chain, roadblock-type 1, dynein-associated protein HKM23, Dynein-associated protein Km23, roadblock domain containing 1, Roadblock domain-containing protein 1, ROBL/LC7-like 1, ROBLD1Roadblock-1

Gene Symbol

DYNLRB1

Additional Dynein light chain 2a cytoplasmic Products

Product Documents for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free and earn rewards!

Have you used Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies