EB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84927

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Analysis in human cerebral cortex and testis tissues. Corresponding MAPRE2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human cerebral cortex, colon, liver and testis using Anti-MAPRE2 antibody NBP1-84927 (A) shows similar protein distribution across tissues to independent antibody NBP1-84926 (B).
Western Blot: EB2 Antibody [NBP1-84927]

Western Blot: EB2 Antibody [NBP1-84927]

Western Blot: EB2 Antibody [NBP1-84927] - Analysis in control (vector only transfected HEK293T lysate) and MAPRE2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927]

Immunohistochemistry-Paraffin: EB2 Antibody [NBP1-84927] - Staining of human colon shows moderate cytoplasmic positivity in peripheral nerve / ganglion.

Applications for EB2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EB2

EB2 is encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.

Alternate Names

APC-binding protein EB2, EB1, EB2APC-binding protein EB1, End-binding protein 2, microtubule-associated protein, RP/EB family, member 2, RP1microtubule-associated protein RP/EB family member 2, T-cell activation protein, EB1 family

Gene Symbol

MAPRE2

Additional EB2 Products

Product Documents for EB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EB2 Antibody - BSA Free and earn rewards!

Have you used EB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...