EEF1A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33983

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EEF1A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EEF1A2 Antibody - BSA Free

Western Blot: EEF1A2 Antibody [NBP2-33983]

Western Blot: EEF1A2 Antibody [NBP2-33983]

Western Blot: EEF1A2 Antibody [NBP2-33983] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33983]

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33983]

Immunohistochemistry-Paraffin: EEF1A2 Antibody [NBP2-33983] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Applications for EEF1A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EEF1A2

EEF1A2 encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, statin-S1, STN, STNL

Gene Symbol

EEF1A2

UniProt

Q05639 (Human)

Additional EEF1A2 Products

Product Documents for EEF1A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EEF1A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EEF1A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EEF1A2 Antibody - BSA Free and earn rewards!

Have you used EEF1A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies