EEF1G Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38481

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 168-437 of human EEF1G (NP_001395.1).

Sequence:
LLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EEF1G Antibody - BSA Free

EEF1G Antibody

Western Blot: EEF1G Antibody [NBP3-38481] -

Western Blot: EEF1G Antibody [NBP3-38481] - Western blot analysis of various lysates using EEF1G Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
EEF1G Antibody

Immunohistochemistry: EEF1G Antibody [NBP3-38481] -

Immunohistochemistry: EEF1G Antibody [NBP3-38481] - Immunohistochemistry analysis of paraffin-embedded Rat brain using EEF1G Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
EEF1G Antibody

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody [NBP3-38481] -

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody [NBP3-38481] - Immunofluorescence analysis of NIH-3T3 cells using EEF1G Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EEF1G Antibody

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody [NBP3-38481] -

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody [NBP3-38481] - Immunofluorescence analysis of C6 cells using EEF1G Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
EEF1G Antibody

Immunohistochemistry: EEF1G Antibody [NBP3-38481] -

Immunohistochemistry: EEF1G Antibody [NBP3-38481] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using EEF1G Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
EEF1G Antibody

Immunohistochemistry: EEF1G Antibody [NBP3-38481] -

Immunohistochemistry: EEF1G Antibody [NBP3-38481] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using EEF1G Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for EEF1G Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EEF1G

EEF1G encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Alternate Names

eEF-1B gamma, EF-1-gamma, EF1Gelongation factor 1-gamma, eukaryotic translation elongation factor 1 gamma, GIG35, pancreatic tumor-related protein, PRO1608, translation elongation factor eEF-1 gamma chain

Gene Symbol

EEF1G

Additional EEF1G Products

Product Documents for EEF1G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EEF1G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EEF1G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EEF1G Antibody - BSA Free and earn rewards!

Have you used EEF1G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...