EHF Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10533

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse EHF (NP_031940). Peptide sequence SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EHF Antibody - BSA Free

Immunohistochemistry: EHF Antibody [NBP3-10533]

Immunohistochemistry: EHF Antibody [NBP3-10533]

Immunohistochemistry: EHF Antibody [NBP3-10533] - Immunohistochemical analysis of human kidney.

Applications for EHF Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EHF

ETS homologous factor (ETS), also known as ETS domain-containing transcription factor, epithelium-specific ETS transcription factor 3, EHF, ESE3, ESE3B, and ESEJ, is a member of the ETS family. This family is characterized by epithelial-specific expression (ESEs). ETS acts as a transcriptional repressor for a specific subset of ETS/AP-1 responsive genes and a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. As such, ETS may play a role in epithelial differentiation and carcinogenesis. ETS is also involved in TNFRSF10B/DR5 regulation through the ETS-binding sequences on the TNFRSF10B/DR5 promoter.

Alternate Names

Epithelium-specific Ets transcription factor 3, ESE-3, ESE3 transcription factor, ESE3B, ESE3hEHF, ESEJepithelium-specific ets factor 3, ETS domain-containing transcription factor, ets homologous factor

Gene Symbol

EHF

Additional EHF Products

Product Documents for EHF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EHF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EHF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EHF Antibody - BSA Free and earn rewards!

Have you used EHF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...