eIF2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57644

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eIF2B1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF2B1(eukaryotic translation initiation factor 2B, subunit 1 alpha) The peptide sequence was selected from the C terminal of EIF2B1. Peptide sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eIF2B1 Antibody - BSA Free

Western Blot: eIF2B1 Antibody [NBP1-57644]

Western Blot: eIF2B1 Antibody [NBP1-57644]

Western Blot: eIF2B1 Antibody [NBP1-57644] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: eIF2B1 Antibody [NBP1-57644]

Immunohistochemistry: eIF2B1 Antibody [NBP1-57644]

Immunohistochemistry: eIF2B1 Antibody [NBP1-57644] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for eIF2B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF2B1

EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Alternate Names

EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit alpha, EIF-2Balpha, EIF2BAMGC117409, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD), eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa, MGC125868, MGC125869, translation initiation factor eIF-2B subunit alpha

Gene Symbol

EIF2B1

UniProt

Q14232 (Human)

Additional eIF2B1 Products

Product Documents for eIF2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eIF2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF2B1 Antibody - BSA Free and earn rewards!

Have you used eIF2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies