EIF3B Antibody (4T9V1)

Novus Biologicals | Catalog # NBP3-16765

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4T9V1 expressed in HEK293
View all EIF3B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human EIF3B (NP_003742.2). VPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF3B Antibody (4T9V1)

Western Blot: EIF3B Antibody (4T9V1) [NBP3-16765]

Western Blot: EIF3B Antibody (4T9V1) [NBP3-16765]

Western Blot: EIF3B Antibody (4T9V1) [NBP3-16765] - Western blot analysis of extracts of various cell lines, using EIF3B Rabbit mAb (NBP3-16765) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
EIF3B Antibody (4T9V1)

Immunocytochemistry/ Immunofluorescence: EIF3B Antibody (4T9V1) [NBP3-16765] -

Immunocytochemistry/ Immunofluorescence: EIF3B Antibody (4T9V1) [NBP3-16765] - Immunofluorescence analysis of NIH-3T3 cells using EIF3B Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
EIF3B Antibody (4T9V1)

Immunocytochemistry/ Immunofluorescence: EIF3B Antibody (4T9V1) [NBP3-16765] -

Immunocytochemistry/ Immunofluorescence: EIF3B Antibody (4T9V1) [NBP3-16765] - Immunofluorescence analysis of C6 cells using EIF3B Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for EIF3B Antibody (4T9V1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EIF3B

Eukaryotic initiation factor 3 subunit B (eIF3B) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3B is a conserved subunit and part of the functional core of eIF3. It bears a non-canonical RNA recognition motif (RRM) and interacts directly with the eIF3S1 subunit.

Alternate Names

eIF3 p110, eIF3 p116, eIF3b, eIF-3-eta, EIF3-P110, EIF3-P116, EIF3S9EIF3-ETA, Eukaryotic translation initiation factor 3 subunit 9, eukaryotic translation initiation factor 3 subunit B, eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD), eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, eukaryotic translation initiation factor 3, subunit B, MGC104664, MGC131875, Prt1 homolog, PRT1hPrt1

Gene Symbol

EIF3B

Additional EIF3B Products

Product Documents for EIF3B Antibody (4T9V1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF3B Antibody (4T9V1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF3B Antibody (4T9V1)

There are currently no reviews for this product. Be the first to review EIF3B Antibody (4T9V1) and earn rewards!

Have you used EIF3B Antibody (4T9V1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies