EIF3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87341

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human EIF3B. Peptide sequence: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EIF3B Antibody - BSA Free

Western Blot: EIF3B Antibody [NBP2-87341]

Western Blot: EIF3B Antibody [NBP2-87341]

Western Blot: EIF3B Antibody [NBP2-87341] - WB Suggested Anti-EIF3S9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysateEIF3B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341]

Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341]

Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341] - Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue. Observed Staining: Cytoplasm. Primary Antibody Concentration: 1:600.

Applications for EIF3B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3B

Eukaryotic initiation factor 3 subunit B (eIF3B) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3B is a conserved subunit and part of the functional core of eIF3. It bears a non-canonical RNA recognition motif (RRM) and interacts directly with the eIF3S1 subunit.

Alternate Names

eIF3 p110, eIF3 p116, eIF3b, eIF-3-eta, EIF3-P110, EIF3-P116, EIF3S9EIF3-ETA, Eukaryotic translation initiation factor 3 subunit 9, eukaryotic translation initiation factor 3 subunit B, eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD), eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, eukaryotic translation initiation factor 3, subunit B, MGC104664, MGC131875, Prt1 homolog, PRT1hPrt1

Gene Symbol

EIF3B

Additional EIF3B Products

Product Documents for EIF3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF3B Antibody - BSA Free and earn rewards!

Have you used EIF3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...