EIF3G Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10537

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EIF3G Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF3G (NP_003746). Peptide sequence LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EIF3G Antibody - BSA Free

Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537] - Host: Rabbit. Target Name: EIF3G. Sample Type: MCF7. Antibody Dilution: 1.0ug/ml EIF3G is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537] - WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate
Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537]

Western Blot: EIF3G Antibody [NBP3-10537] - Host: Rabbit. Target Name: EIF3G. Sample Type: 293T. Antibody Dilution: 1.0ug/ml EIF3G is supported by BioGPS gene expression data to be expressed in HEK293T

Applications for EIF3G Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3G

Eukaryotic initiation factor 3 subunit G (eIF3G) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3G has been shown to directly interact with AIF (apoptosis inducing factor), a protein that plays a role in caspase-independent apoptosis. AIF is able to inhibit protein synthesis via its interaction with eIF3g.

Alternate Names

eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G

Gene Symbol

EIF3G

Additional EIF3G Products

Product Documents for EIF3G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EIF3G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF3G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF3G Antibody - BSA Free and earn rewards!

Have you used EIF3G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies