eIF4E Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57195

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all eIF4E Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF4E(eukaryotic translation initiation factor 4E) The peptide sequence was selected from the C terminal of EIF4E. Peptide sequence TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eIF4E Antibody - BSA Free

Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195] - C-terminal region validated by WB using Mouse Brain lysate.
Immunohistochemistry-Paraffin: eIF4E Antibody [NBP1-57195]

Immunohistochemistry-Paraffin: eIF4E Antibody [NBP1-57195]

Immunohistochemistry-Paraffin: eIF4E Antibody [NBP1-57195] - Human Lung respiratory epithelium tissue, 5ug/ml.
Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195]
Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195]

Western Blot: eIF4E Antibody [NBP1-57195] - HEK293 lysate, mouse brain extract, Antibody Titration: 0.2-1 ug/ml

Applications for eIF4E Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF4E

All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G All eukaryotic cellular mRNAs are blocked at their 5-prime ends with the 7-methylguanosine cap structure, m7GpppX (where X is any nucleotide). This structure is involved in several cellular processes including enhanced translational efficiency, splicing, mRNA stability, and RNA nuclear export. EIF4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It is a 24-kD polypeptide that exists as both a free form and as part of a multiprotein complex termed EIF4F. The EIF4E polypeptide is the rate-limiting component of the eukaryotic translation apparatus and is involved in the mRNA-ribosome binding step of eukaryotic protein synthesis. The other subunits of EIF4F are a 50-kD polypeptide, termed EIF4A (see MIM 601102), that possesses ATPase and RNA helicase activities, and a 220-kD polypeptide, EIF4G (MIM 600495) (Rychlik et al., 1987 [PubMed 3469651]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Eukaryotic Translation Initiation Factor 4E

Alternate Names

EIF4EL1, EIF4F

Gene Symbol

EIF4E

UniProt

P06730

Additional eIF4E Products

Product Documents for eIF4E Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for eIF4E Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons
Translation Regulation

Customer Reviews for eIF4E Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF4E Antibody - BSA Free and earn rewards!

Have you used eIF4E Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies