![Western Blot: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Western-Blot-NBP2-49646-img0002.jpg "Western Blot: ELF2 Antibody [NBP2-49646]")
Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (91%), Rat (95%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ELF2 Antibody - BSA Free
Western Blot: ELF2 Antibody [NBP2-49646]
Western Blot: ELF2 Antibody [NBP2-49646] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
![Immunocytochemistry/ Immunofluorescence: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49646-img0003.jpg "Immunocytochemistry/ Immunofluorescence: ELF2 Antibody [NBP2-49646]")
Immunocytochemistry/ Immunofluorescence: ELF2 Antibody [NBP2-49646]
Immunocytochemistry/Immunofluorescence: ELF2 Antibody [NBP2-49646] - Staining of human cell line RT4 shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-49646-img0007.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human testis.![Immunohistochemistry: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-NBP2-49646-img0001.jpg "Immunohistochemistry: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry: ELF2 Antibody [NBP2-49646]
Immunohistochemistry: ELF2 Antibody [NBP2-49646] - Staining of human duodenum shows nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-49646-img0004.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human colon, lymph node, placenta and testis using Anti-ELF2 antibody NBP2-49646 (A) shows similar protein distribution across tissues to independent antibody NBP1-84770 (B).![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-49646-img0005.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human colon.![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-49646-img0006.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human placenta.![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-49646-img0008.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human lymph node.
Chromatin Immunoprecipitation ChIP: ELF2 Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-ELF2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for ELF2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ELF2
Alternate Names
b, E74-like factor 2, E74-like factor 2 (ets domain transcription factor), ets family transcription factor ELF2C, ETS-related transcription factor Elf-2, NERF-1a, NERF-1B, NERF-2, NERFEU32, New ETS-related factor
Gene Symbol
ELF2
Additional ELF2 Products
Product Documents for ELF2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ELF2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ELF2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ELF2 Antibody - BSA Free and earn rewards!
Have you used ELF2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...