EML4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35647

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EML4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 360-560 of human EML4 (NP_061936.2).

Sequence:
GTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

109 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for EML4 Antibody - BSA Free

EML4 Antibody

Immunohistochemistry: EML4 Antibody [NBP3-35647] -

Immunohistochemistry: EML4 Antibody [NBP3-35647] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using EML4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EML4 Antibody

Western Blot: EML4 Antibody [NBP3-35647] -

Western Blot: EML4 Antibody [NBP3-35647] - Western blot analysis of lysates from HepG2 cells, using EML4 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
EML4 Antibody

Immunohistochemistry: EML4 Antibody [NBP3-35647] -

Immunohistochemistry: EML4 Antibody [NBP3-35647] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using EML4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EML4 Antibody

Immunohistochemistry: EML4 Antibody [NBP3-35647] -

Immunohistochemistry: EML4 Antibody [NBP3-35647] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using EML4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
EML4 Antibody

Immunocytochemistry/ Immunofluorescence: EML4 Antibody [NBP3-35647] -

Immunocytochemistry/ Immunofluorescence: EML4 Antibody [NBP3-35647] - Immunofluorescence analysis of L929 cells using EML4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for EML4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EML4

Echinoderm microtubule associated protein like 4 (EML4) has been identified as part of a gene fusion with the kinase domain of the anaplastic lymphoma receptor tyrosine kinase (ALK) in non-small cell lung cancer. EML4 associates with in vitro polymerized microtubules. In the cell, phosphorylated EML4 associates with the mitotic spindle and is essential for proliferation and microtubule network formation. Alternative names for EML4 include EMAPL4, ropp120, C2orf2, ELP120, and EMAP-4.

Alternate Names

C2orf2, echinoderm microtubule associated protein like 4, echinoderm microtubule-associated protein-like 4, ELP120, EMAP-4, EMAPL4, FLJ10942, FLJ32318, Restrictedly overexpressed proliferation-associated protein, Ropp 120, ROPP120DKFZp686P18118

Gene Symbol

EML4

Additional EML4 Products

Product Documents for EML4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EML4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EML4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EML4 Antibody - BSA Free and earn rewards!

Have you used EML4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies