ENPP-1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38945
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Predicted:
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ENPP-1 Antibody - BSA Free
Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-38945]
Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-38945] - Staining of human placenta shows cytoplasmic positivity in stromal cells.Western Blot: Rabbit Polyclonal ENPP-1 Antibody [NBP2-38945]
Western Blot: Rabbit Polyclonal ENPP-1 Antibody [NBP2-38945] - Western Blot on human valvular intersticial cell samples. Experiment used precast gel, migration at 190 V and a High weight transfer with the transblot. Then the membrane was blocked with BSA 5% for 1 hour and incubated overnight with ENPP-1 Antibody at 1/1000. The next day, after 3 washing we incubated the membrane with anti-rabbit at 1/1000 for 1h at room temperature. After 2 washing we imaged at 800nm. Image from a verified customer review.Applications for ENPP-1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 4 using NBP2-38945 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ENPP-1
Long Name
Ectonucleotide Pyrophosphatase/Phosphodiesterase 1
Alternate Names
ENPP1, Ly-41 Antigen, M6S1, NPP1, NPPS, PCA1, PDNP1
Gene Symbol
ENPP1
UniProt
Additional ENPP-1 Products
Product Documents for ENPP-1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ENPP-1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ENPP-1 Antibody - BSA Free
Customer Reviews for ENPP-1 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used ENPP-1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Human valvular intersticial cellsSpecies: HumanVerified Customer | Posted 12/02/2024Chemidoc 800 nmWe did a western blot on human cells sample to determine the best quantity to use and load in wells. So, we used precast gel, migration at 190 V and a High weight transfer with the transblot. Then we blocked the membrane with BSA 5% for 1 hour and incubated overnight with the antibody at 1/1000. The next day, after 3 washing we incubated the membrane with anti-rabbit at 1/1000 for 1h at room temperature. After 2 washing we imaged at 800nm.Bio-Techne ResponseThis review reflects a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...