ERAB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38154

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human ERAB (NP_004484.1).

Sequence:
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ERAB Antibody - BSA Free

ERAB Antibody

Immunocytochemistry/ Immunofluorescence: ERAB Antibody [NBP3-38154] -

Immunocytochemistry/ Immunofluorescence: ERAB Antibody [NBP3-38154] - Immunofluorescence analysis of U-2 OS cells using ERAB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ERAB Antibody

Western Blot: ERAB Antibody [NBP3-38154] -

Western Blot: ERAB Antibody [NBP3-38154] - Western Blot analysis of various lysates using ERAB Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
ERAB Antibody

Immunohistochemistry: ERAB Antibody [NBP3-38154] -

Immunohistochemistry: ERAB Antibody [NBP3-38154] - Immunohistochemistry analysis of paraffin-embedded Human colon using ERAB/ERAB/HSD17B10 Rabbit pAb (A5448) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for ERAB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ERAB

ERAB encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimer's disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Alternate Names

17-beta-HSD 10, 17-beta-hydroxysteroid dehydrogenase 10, 17b-HSD10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, ABAD, amyloid-beta peptide binding alcohol dehydrogenase, CAMR, DUPXp11.22, EC 1.1.1.178, EC 1.1.1.35, Endoplasmic reticulum-associated amyloid beta-peptide-binding protein, ERAB3-hydroxyacyl-CoA dehydrogenase type-2, HADH2AB-binding alcohol dehydrogenase, hydroxyacyl-Coenzyme A dehydrogenase, type II, hydroxyacyl-Coenzyme Adehydrogenase, type II, hydroxysteroid (17-beta) dehydrogenase 10, mental retardation, X-linked, syndromic 10, MHBD, Mitochondrial ribonuclease P protein 2,3-hydroxyacyl-CoA dehydrogenase type II, Mitochondrial RNase P protein 2, MRPP2HCD2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, short chain dehydrogenase/reductase family 5C, member 1, short chain L-3-hydroxyacyl-CoA dehydrogenase type 2, short chain type dehydrogenase/reductase XH98G2, Short-chain type dehydrogenase/reductase XH98G2, Type II HADH, XH98G2

Gene Symbol

HSD17B10

Additional ERAB Products

Product Documents for ERAB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERAB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERAB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERAB Antibody - BSA Free and earn rewards!

Have you used ERAB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...