ERR alpha/NR3B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56812

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ERR alpha/NR3B1 Antibody - BSA Free

Western Blot: ERR alpha/NR3B1 Antibody [NBP2-56812]

Western Blot: ERR alpha/NR3B1 Antibody [NBP2-56812]

Western Blot: ERR alpha/NR3B1 Antibody [NBP2-56812] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ERR alpha/NR3B1 Antibody [NBP2-56812]

Immunocytochemistry/ Immunofluorescence: ERR alpha/NR3B1 Antibody [NBP2-56812]

Immunocytochemistry/Immunofluorescence: ERR alpha/NR3B1 Antibody [NBP2-56812] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli fibrillar center, microtubules & cytokinetic bridge.
ERR alpha/NR3B1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ERR alpha/NR3B1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ERR alpha/NR3B1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ERR alpha/NR3B1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for ERR alpha/NR3B1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERR alpha/NR3B1

Estrogen-related receptor alpha (ERR alpha) is an orphan member of the superfamily of nuclear hormone receptors. ERR alpha was initially isolated based on its sequence homology to the estrogen receptor but is not activated by classic estrogens. Binding site selection experiments show that ERR alpha preferentially binds to an ERR alpha response element (ERRE) containing a single consensus half-site, TNAAGGTCA. Data demonstrate that ERR alpha can control the expression of MCAD through the NRRE-1 and thus may play an important role in regulating cellular energy balance in vivo (1). The estrogen-related receptors ERRalpha and ERRbeta (formerly ERR1 and ERR2) form a subgroup of the steroid/thyroid/retinoid receptor family. ERRalpha and ERRbeta are homologous to the estrogen receptor and bind similar DNA targets; however, they are unable to activate gene transcription in response to estrogens (2).

Long Name

Estrogen-related Receptor alpha

Alternate Names

ERR1, ESRL1, ESRRA, NR3B1

Gene Symbol

ESRRA

Additional ERR alpha/NR3B1 Products

Product Documents for ERR alpha/NR3B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ERR alpha/NR3B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ERR alpha/NR3B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ERR alpha/NR3B1 Antibody - BSA Free and earn rewards!

Have you used ERR alpha/NR3B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...