ETFA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84854

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GGSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ETFA Antibody - BSA Free

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human colon, kidney, liver and pancreas using Anti-ETFA antibody NBP1-84854 (A) shows similar protein distribution across tissues to independent antibody NBP1-84856 (B).
Western Blot: ETFA Antibody [NBP1-84854]

Western Blot: ETFA Antibody [NBP1-84854]

Western Blot: ETFA Antibody [NBP1-84854] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ETFA antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: ETFA Antibody [NBP1-84854]

Immunocytochemistry/ Immunofluorescence: ETFA Antibody [NBP1-84854]

Immunocytochemistry/Immunofluorescence: ETFA Antibody [NBP1-84854] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Western Blot: ETFA Antibody [NBP1-84854]

Western Blot: ETFA Antibody [NBP1-84854]

Western Blot: ETFA Antibody [NBP1-84854] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854]

Immunohistochemistry-Paraffin: ETFA Antibody [NBP1-84854] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.

Applications for ETFA Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ETFA

ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

Alpha-ETF, electron transfer flavoprotein alpha-subunit, Electron transfer flavoprotein subunit alpha, mitochondrial, electron-transfer-flavoprotein, alpha polypeptide, EMA, GA2, Glutaric Aciduria II, MADD

Gene Symbol

ETFA

Additional ETFA Products

Product Documents for ETFA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ETFA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ETFA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ETFA Antibody - BSA Free and earn rewards!

Have you used ETFA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...