EYA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87382

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EYA1. Peptide sequence: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EYA1 Antibody - BSA Free

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: EYA1 Antibody [NBP2-87382]

Immunohistochemistry: EYA1 Antibody [NBP2-87382]

Immunohistochemistry: EYA1 Antibody [NBP2-87382] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human PC-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human U937 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382]

Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Applications for EYA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EYA1

The EYA1 gene encodes an eyes absent homolog 1 protein that exists in three isoforms: isoform 1: 592 amino acids long, 64 kDA; isoform 2: 559 amino acids long, 61 kDA; and isoform 3: 557 amino acids long; 60 kDA. The protein coded by the EYA1 gene functions in the development of the kidney, brancial arches, eyes, and ears. Mutations in the EYA1 gene lead to branchiootorenal dysplasia syndrome, congenital cataracts and ocular anterior segment anomalies, and branchiootic syndrome. The EYA1 gene is also linked to fraser syndrome, microphthalmia, cataracts, enlarged vestibular aqueducts, townes-brocks syndrome, and anophthalmia.

Alternate Names

BOP, BOR, EC 3.1.3.48, eyes absent (Drosophila) homolog 1, eyes absent homolog 1, eyes absent homolog 1 (Drosophila), MGC141875

Gene Symbol

EYA1

Additional EYA1 Products

Product Documents for EYA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EYA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EYA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EYA1 Antibody - BSA Free and earn rewards!

Have you used EYA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...