FAM114A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89407

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SATVATVGQGISNVIEKAETSLGIPSPSEISTEVKYVAGETNAKENENSSPVAGAFGVFSTISTAVQSTGKSVISG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM114A2 Antibody - BSA Free

FAM114A2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: FAM114A2 Antibody - BSA Free [NBP1-89407]

Immunocytochemistry/ Immunofluorescence: FAM114A2 Antibody - BSA Free [NBP1-89407]

Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407] - Staining of human lymph node shows weak cytoplasmic positivity in non-germinal center cells.
FAM114A2 Antibody - BSA Free Immunohistochemistry-Paraffin: FAM114A2 Antibody - BSA Free [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody - BSA Free [NBP1-89407]

Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407]

Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
FAM114A2 Antibody - BSA Free Western Blot: FAM114A2 Antibody - BSA Free [NBP1-89407]

Western Blot: FAM114A2 Antibody - BSA Free [NBP1-89407]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
FAM114A2 Antibody - BSA Free Western Blot: FAM114A2 Antibody - BSA Free [NBP1-89407]

Western Blot: FAM114A2 Antibody - BSA Free [NBP1-89407]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for FAM114A2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM114A2

Alternate Names

C5orf3, chromosome 5 open reading frame 3, family with sequence similarity 114, member A2,133K02, hypothetical protein LOC10827

Gene Symbol

FAM114A2

Additional FAM114A2 Products

Product Documents for FAM114A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAM114A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FAM114A2 Antibody - BSA Free

Customer Reviews for FAM114A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM114A2 Antibody - BSA Free and earn rewards!

Have you used FAM114A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...