FAM130A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58064

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FAM130A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG

Reactivity Notes

Mouse 88%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FAM130A1 Antibody - BSA Free

Western Blot: FAM130A1 Antibody [NBP2-58064]

Western Blot: FAM130A1 Antibody [NBP2-58064]

Western Blot: FAM130A1 Antibody [NBP2-58064] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: FAM130A1 Antibody [NBP2-58064]

Immunocytochemistry/ Immunofluorescence: FAM130A1 Antibody [NBP2-58064]

Immunocytochemistry/Immunofluorescence: FAM130A1 Antibody [NBP2-58064] - Staining of human cell line SiHa shows localization to nuclear speckles.

Applications for FAM130A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FAM130A1

FAM130A1 binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. Mayplay a role in apoptosis

Alternate Names

C12ORF2, C12orf22, CSRNP-2, cysteine/serine-rich nuclear protein 2, cysteine-serine-rich nuclear protein 2, FAM130A1, family with sequence similarity 130, member A1, FLJ25576, Protein FAM130A1, TAIP12, TAIP-12chromosome 12 open reading frame 22, TGF-beta-induced apoptosis protein 12

Gene Symbol

CSRNP2

Additional FAM130A1 Products

Product Documents for FAM130A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FAM130A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FAM130A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FAM130A1 Antibody - BSA Free and earn rewards!

Have you used FAM130A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies