Fas Ligand/TNFSF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49160

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fas Ligand/TNFSF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human lymph node shows distinct cytoplasmic positivity in subsets of cells.
Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human rectum shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160]

Immunohistochemistry-Paraffin: Fas Ligand/TNFSF6 Antibody [NBP2-49160] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Applications for Fas Ligand/TNFSF6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fas Ligand/TNFSF6

Fas / APO-1 (CD95) is an important member of the tumour necrosis factor (TNF) superfamily involved in membrane-mediated apoptosis. Ligation of Fas by Fas Ligand (Fas-L) or an anti-Fas cross-linking antibody, triggers activation of the caspase cascade. Functional impairment of the Fas / Fas-L system is associated with the development and progression of malignancies. Fas gene mutations have been suggested to have a role in testicular germ cell tumours. Tumour cells frequently exhibit de novo expression of Fas Ligand (Fas-L), which plays a significant role in local tissue destruction, metastatic spread, and immune escape of the tumor cells. The apoptosis of lymphocytes, which occurs in autoimmune diseases, is usually induced by the Fas/Fas-L system. Fas is believed to be involved in various autoimmune diseases including, ulcerative colitis, Graves disease, and rheumatoid arthritis. Fas expression on gastric epithelial cells in patients infected with H.Pylori is responsible for the accelerated apoptosis of the cells. Serum Fas-L concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension.

Alternate Names

CD178, CD95L, FASLG, TNFSF6

Gene Symbol

FASLG

Additional Fas Ligand/TNFSF6 Products

Product Documents for Fas Ligand/TNFSF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fas Ligand/TNFSF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fas Ligand/TNFSF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fas Ligand/TNFSF6 Antibody - BSA Free and earn rewards!

Have you used Fas Ligand/TNFSF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies