Fatty acid desaturase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82734

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Fatty acid desaturase 2. Peptide sequence: VFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Fatty acid desaturase 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734] - IHC - Paraffin (10 ug/ml)
Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734] - IHC - Paraffin (10 ug/ml)

Applications for Fatty acid desaturase 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fatty acid desaturase 2

The protein encoded by the Fatty acid desaturase 2 gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq]

Long Name

Acyl-CoA 6-desaturase

Alternate Names

D6D, Delta(6) desaturase, Delta-6 desaturase, EC 1.14.19.3, FADS2

Gene Symbol

FADS2

Additional Fatty acid desaturase 2 Products

Product Documents for Fatty acid desaturase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fatty acid desaturase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fatty acid desaturase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fatty acid desaturase 2 Antibody - BSA Free and earn rewards!

Have you used Fatty acid desaturase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...