FCHO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90904

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FCHO2 Antibody - BSA Free

FCHO2 Antibody Immunohistochemistry-Paraffin: FCHO2 Antibody Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody Antibody [NBP1-90904]

Staining of human endometrium, kidney, placenta and skeletal muscle using NBP1-90904 (A) shows similar protein distribution across tissues to independent antibody NBP2-32694 (B).
FCHO2 Antibody - BSA Free Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
FCHO2 Antibody - BSA Free Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
FCHO2 Antibody - BSA Free Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
FCHO2 Antibody - BSA Free Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
FCHO2 Antibody - BSA Free Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Immunohistochemistry: FCHO2 Antibody - BSA Free [NBP1-90904]

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
FCHO2 Antibody - BSA Free Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP1-90904]

Staining of human endometrium, kidney, placenta and skeletal muscle HPA037686 (A) shows similar protein distribution across tissues to independent antibody HPA037685 (B).

Applications for FCHO2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCHO2

Alternate Names

FCH domain only 2

Gene Symbol

FCHO2

Additional FCHO2 Products

Product Documents for FCHO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FCHO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FCHO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FCHO2 Antibody - BSA Free and earn rewards!

Have you used FCHO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...