FGFR1OP Antibody (2T2F9)

Novus Biologicals | Catalog # NBP3-33266

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2T2F9
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human FGFR1OP (NP_008976.1).

Sequence:
PSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FGFR1OP Antibody (2T2F9)

FGFR1OP Antibody (2T2F9)

Western Blot: FGFR1OP Antibody (2T2F9) [NBP3-33266] -

Western Blot: FGFR1OP Antibody (2T2F9) [NBP3-33266] - Western blot analysis of lysates from HeLa cells using FGFR1OP Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
FGFR1OP Antibody (2T2F9)

Western Blot: FGFR1OP Antibody (2T2F9) [NBP3-33266] -

Western Blot: FGFR1OP Antibody (2T2F9) [NBP3-33266] - Western blot analysis of lysates from HeLa cells using FGFR1OP Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
FGFR1OP Antibody (2T2F9)

Immunocytochemistry/ Immunofluorescence: FGFR1OP Antibody (2T2F9) [NBP3-33266] -

Immunocytochemistry/ Immunofluorescence: FGFR1OP Antibody (2T2F9) [NBP3-33266] - Immunofluorescence analysis of NIH/3T3 cells using FGFR1OP Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
FGFR1OP Antibody (2T2F9)

Immunocytochemistry/ Immunofluorescence: FGFR1OP Antibody (2T2F9) [NBP3-33266] -

Immunocytochemistry/ Immunofluorescence: FGFR1OP Antibody (2T2F9) [NBP3-33266] - Immunofluorescence analysis of U-937 cells using FGFR1OP Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for FGFR1OP Antibody (2T2F9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FGFR1OP

The FGFR1OP gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myelo

Alternate Names

FGFR1 oncogene partner, FOPfibroblast growth factor receptor 1 oncogene partner

Gene Symbol

CEP43

Additional FGFR1OP Products

Product Documents for FGFR1OP Antibody (2T2F9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGFR1OP Antibody (2T2F9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGFR1OP Antibody (2T2F9)

There are currently no reviews for this product. Be the first to review FGFR1OP Antibody (2T2F9) and earn rewards!

Have you used FGFR1OP Antibody (2T2F9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...