FHL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91899

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FHL3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids:CNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FHL3 Antibody - BSA Free

Western Blot: FHL3 Antibody [NBP1-91899]

Western Blot: FHL3 Antibody [NBP1-91899]

Western Blot: FHL3 Antibody [NBP1-91899] - Analysis in control (vector only transfected HEK293T lysate) and FHL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: FHL3 Antibody [NBP1-91899]

Immunocytochemistry/ Immunofluorescence: FHL3 Antibody [NBP1-91899]

Immunocytochemistry/Immunofluorescence: FHL3 Antibody [NBP1-91899] - Staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.
FHL3 Antibody - BSA Free Western Blot: FHL3 Antibody - BSA Free [NBP1-91899]

Western Blot: FHL3 Antibody - BSA Free [NBP1-91899]

Analysis in control (vector only transfected HEK293T lysate) and FHL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for FHL3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions for ICC/IF, Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FHL3

LIM proteins are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]

Alternate Names

FHL-3, four and a half LIM domains 3, four and a half LIM domains protein 3, LIM-only protein FHL3, MGC19547, MGC8696, Skeletal muscle LIM-protein 2, SLIM-2, SLIM2MGC23614

Gene Symbol

FHL3

Additional FHL3 Products

Product Documents for FHL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FHL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FHL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FHL3 Antibody - BSA Free and earn rewards!

Have you used FHL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies