Fibrinogen gamma chain Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69291

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Fibrinogen gamma chain Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FGG(fibrinogen gamma chain) The peptide sequence was selected from the middle region of Fibrinogen gamma chain. Peptide sequence GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Fibrinogen gamma chain Antibody - BSA Free

Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291]

Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291]

Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Fibrinogen gamma chain Antibody [NBP1-69291]

Immunohistochemistry: Fibrinogen gamma chain Antibody [NBP1-69291]

Immunohistochemistry: Fibrinogen gamma chain Antibody [NBP1-69291] - Placenta tissue
Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291]

Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291]

Western Blot: Fibrinogen gamma chain Antibody [NBP1-69291] - This Anti-FGG antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Applications for Fibrinogen gamma chain Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fibrinogen gamma chain

Fibrinogen gamma chain is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

Alternate Names

fibrinogen gamma chain, fibrinogen, gamma polypeptide

Gene Symbol

FGG

Additional Fibrinogen gamma chain Products

Product Documents for Fibrinogen gamma chain Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Fibrinogen gamma chain Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fibrinogen gamma chain Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fibrinogen gamma chain Antibody - BSA Free and earn rewards!

Have you used Fibrinogen gamma chain Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies