Fibrinopeptide B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35409

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Fibrinopeptide B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).

Sequence:
QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Fibrinopeptide B Antibody - BSA Free

Fibrinopeptide B Antibody

Immunocytochemistry/ Immunofluorescence: Fibrinopeptide B Antibody [NBP3-35409] -

Immunocytochemistry/ Immunofluorescence: Fibrinopeptide B Antibody [NBP3-35409] - Immunofluorescence analysis of HepG2 cells using Fibrinopeptide B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Fibrinopeptide B Antibody

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] -

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] - Western blot analysis of lysates from HepG2 cells, using Fibrinopeptide B Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Fibrinopeptide B Antibody

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] -

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] - Western blot analysis of various lysates using Fibrinopeptide B Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Fibrinopeptide B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Fibrinopeptide B

The protein encoded by the Fibrinopeptide B gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of threepairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrinwhich is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrinregulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for severalcell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia,hypodysfibrinogenemia and thrombotic tendency. (provided by RefSeq)

Alternate Names

Beta-Fibrinogen, FGB Peptide, FIBB, Fibrinogen beta chain, Fibrinogen Type II, FPB

Gene Symbol

FGB

Additional Fibrinopeptide B Products

Product Documents for Fibrinopeptide B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Fibrinopeptide B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fibrinopeptide B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fibrinopeptide B Antibody - BSA Free and earn rewards!

Have you used Fibrinopeptide B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies