FMO5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59731

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FMO5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FMO5(flavin containing monooxygenase 5) The peptide sequence was selected from the middle region of FMO5. Peptide sequence NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FMO5 Antibody - BSA Free

Western Blot: FMO5 Antibody [NBP1-59731]

Western Blot: FMO5 Antibody [NBP1-59731]

Western Blot: FMO5 Antibody [NBP1-59731] - Hela cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: FMO5 Antibody [NBP1-59731]

Immunohistochemistry: FMO5 Antibody [NBP1-59731]

Immunohistochemistry: FMO5 Antibody [NBP1-59731] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.

Applications for FMO5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FMO5

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting

Alternate Names

dimethylaniline monooxygenase [N-oxide-forming] 5, Dimethylaniline oxidase 5, EC 1.14.13.8, flavin containing monooxygenase 5, FMO 5, Hepatic flavin-containing monooxygenase 5

Gene Symbol

FMO5

UniProt

P49326 (Human)

Additional FMO5 Products

Product Documents for FMO5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FMO5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FMO5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FMO5 Antibody - BSA Free and earn rewards!

Have you used FMO5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies