FOLR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69363

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to FOLR1(folate receptor 1 (adult)) The peptide sequence was selected from the middle region of FOLR1. Peptide sequence HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FOLR1 Antibody - BSA Free

Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363] - PANC1 Whole Cell Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane/ Lane Gel Concentration: 0.12.
Immunohistochemistry: FOLR1 Antibody [NBP1-69363]

Immunohistochemistry: FOLR1 Antibody [NBP1-69363]

Immunohistochemistry: FOLR1 Antibody [NBP1-69363] - Human Adult liver Observed Staining: Cytoplasmic,Membrane in bile ducts not in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363] - This Anti-FOLR1 antibody was used in Western Blot of PANC1 tissue lysate at a concentration of 1ug/ml.
Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363] - Sample Tissue: PANC1 Whole Cell, Lane A: Primary Antibody, Lane B:Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.12
Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363]

Western Blot: FOLR1 Antibody [NBP1-69363] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry-Paraffin: FOLR1 Antibody [NBP1-69363]

Immunohistochemistry-Paraffin: FOLR1 Antibody [NBP1-69363]

Immunohistochemistry-Paraffin: FOLR1 Antibody [NBP1-69363] - Folate Binding Protein Antibody [NBP1-69363] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Membrane and cytoplasmic in alveolar type I & II cells

Applications for FOLR1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOLR1

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anc

Long Name

Folate Receptor 1

Alternate Names

FBP, Folbp1, FR-alpha, MOv18

Gene Symbol

FOLR1

UniProt

Additional FOLR1 Products

Product Documents for FOLR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOLR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for FOLR1 Antibody - BSA Free

Customer Reviews for FOLR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOLR1 Antibody - BSA Free and earn rewards!

Have you used FOLR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...