FOX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91910

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FOX2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FOX2 Antibody - BSA Free

Western Blot: FOX2 Antibody [NBP1-91910]

Western Blot: FOX2 Antibody [NBP1-91910]

Western Blot: FOX2 Antibody [NBP1-91910] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/ Immunofluorescence: FOX2 Antibody [NBP1-91910]

Immunocytochemistry/ Immunofluorescence: FOX2 Antibody [NBP1-91910]

Immunocytochemistry/Immunofluorescence: FOX2 Antibody [NBP1-91910] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining in human endometrium and pancreas tissues using anti-RBFOX2 antibody. Corresponding RBFOX2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human placenta shows strong nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910]

Immunohistochemistry-Paraffin: FOX2 Antibody [NBP1-91910] - Staining of human endometrium shows strong positivity in stromal cells.
FOX2 Antibody - BSA Free Western Blot: FOX2 Antibody - BSA Free [NBP1-91910]

Western Blot: FOX2 Antibody - BSA Free [NBP1-91910]

Analysis in human cell line SH-SY5Y.
FOX2 Antibody - BSA Free Immunohistochemistry: FOX2 Antibody - BSA Free [NBP1-91910]

Immunohistochemistry: FOX2 Antibody - BSA Free [NBP1-91910]

Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans.
FOX2 Antibody - BSA Free Immunohistochemistry: FOX2 Antibody - BSA Free [NBP1-91910]

Immunohistochemistry: FOX2 Antibody - BSA Free [NBP1-91910]

Analysis in human endometrium and pancreas tissues using NBP1-91910 antibody. Corresponding RBFOX2 RNA-seq data are presented for the same tissues.

Applications for FOX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOX2

FOX2 is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

dJ106I20.3, Fox-1 homolog B, fox-1 homologue, FOX2Fox-2, fxh, hexaribonucleotide binding protein 2, Hexaribonucleotide-binding protein 2, HRNBP2FOX-2, RBM9RTAHNRBP2, Repressor of tamoxifen transcriptional activity, RNA binding motif protein 9, RNA binding protein fox-1 homolog 2, RNA binding protein, fox-1 homolog (C. elegans) 2, RNA-binding motif protein 9, RNA-binding protein 9

Gene Symbol

RBFOX2

Additional FOX2 Products

Product Documents for FOX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FOX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOX2 Antibody - BSA Free and earn rewards!

Have you used FOX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies