Fumarase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89814

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Fumarase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814]

Immunocytochemistry/ Immunofluorescence: Fumarase Antibody [NBP1-89814]

Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-89814] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of mouse hippocampus shows neuronal immunoreactivity in the CA3 layer.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of mouse globus pallidus shows immunoreactivity in neurons.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of mouse medulla shows positivity in the neurons of the facial nucleus.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of mouse olfactory bulb shows neuronal positivity in the anterior olfactory nucleus.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Fumarase Antibody

Immunohistochemistry: Fumarase Antibody [NBP1-89814]

Immunohistochemistry: Fumarase Antibody [NBP1-89814] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: Fumarase Antibody [NBP1-89814]

Western Blot: Fumarase Antibody [NBP1-89814]

Western Blot: Fumarase Antibody [NBP1-89814] - Analysis using Anti-FH antibody NBP1-89814 (A) shows similar pattern to independent antibody NBP1-89813 (B).
Fumarase Antibody - BSA Free Western Blot: Fumarase Antibody - BSA Free [NBP1-89814]

Western Blot: Fumarase Antibody - BSA Free [NBP1-89814]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for Fumarase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

1.0 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fumarase

Fumarase is encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.

Alternate Names

EC 4.2.1.2, Fumarase, fumarate hydratase, fumarate hydratase, mitochondrial, HLRCC, LRCC, MCL, MCUL1

Gene Symbol

FH

Additional Fumarase Products

Product Documents for Fumarase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fumarase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fumarase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Fumarase Antibody - BSA Free and earn rewards!

Have you used Fumarase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...