FUSIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57428

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to FUSIP1(FUS interacting protein (serine/arginine-rich) 1) The peptide sequence was selected from the C terminal of FUSIP1. Peptide sequence TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FUSIP1 Antibody - BSA Free

Western Blot: FUSIP1 Antibody [NBP1-57428]

Western Blot: FUSIP1 Antibody [NBP1-57428]

Western Blot: FUSIP1 Antibody [NBP1-57428] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate FUSIP1 is supported by BioGPS gene expression data to be expressed in HepG2
Immunohistochemistry: FUSIP1 Antibody [NBP1-57428]

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428]

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400
Immunohistochemistry: FUSIP1 Antibody [NBP1-57428]

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428]

Immunohistochemistry: FUSIP1 Antibody [NBP1-57428] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Applications for FUSIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FUSIP1

FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Alternate Names

40 kDa SR-repressor protein, FLJ43846, FUS interacting protein (serine-arginine rich) 1, FUS-interacting protein (serine-arginine rich) 2, FUS-interacting serine-arginine-rich protein 1, FUSIP1DKFZp686H0644, FUSIP2, neural-salient SR protein, NSSR, serine/arginine-rich splicing factor 10, serine-arginine repressor protein (40 kDa), SFRS13, SFRS13A, Splicing factor SRp38, splicing factor, arginine/serine-rich 13, Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats, SR splicing factor 10, SRp38, SRrp40TLS-associated protein with SR repeats, TASR1TLS-associated SR protein, TASR2FUS interacting protein (serine/arginine-rich) 1, TASRFLJ30749, TLS-associated protein TASR, TLS-associated serine-arginine protein, TLS-associated serine-arginine protein 1, TLS-associated serine-arginine protein 2

Gene Symbol

SRSF10

UniProt

Additional FUSIP1 Products

Product Documents for FUSIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FUSIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FUSIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FUSIP1 Antibody - BSA Free and earn rewards!

Have you used FUSIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...