G-substrate Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68949

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all G-substrate Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMS

Reactivity Notes

Mouse 81%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for G-substrate Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: G-substrate Antibody [NBP2-68949]

Immunocytochemistry/ Immunofluorescence: G-substrate Antibody [NBP2-68949]

Immunocytochemistry/Immunofluorescence: G-substrate Antibody [NBP2-68949] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
G-substrate Antibody Immunohistochemistry-Paraffin: G-substrate Antibody Antibody [NBP2-68949]

Immunohistochemistry-Paraffin: G-substrate Antibody Antibody [NBP2-68949]

Staining of human cerebellum, kidney, liver and placenta using NBP2-68949 (A) shows similar protein distribution across tissues to independent antibody NBP2-13800 (B).
G-substrate Antibody Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
G-substrate Antibody Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Staining of human liver shows no positivity in hepatocytes as expected.
G-substrate Antibody Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Staining of human placenta shows no positivity in trophoblastic cells as expected.
G-substrate Antibody Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Immunohistochemistry-Paraffin: G-substrate Antibody [NBP2-68949]

Staining of human kidney shows no positivity in cells in tubules as expected.
G-substrate Antibody Western Blot: G-substrate Antibody [NBP2-68949]

Western Blot: G-substrate Antibody [NBP2-68949]

Analysis in human cell line SCLC-21H.

Applications for G-substrate Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G-substrate

G-substrate inhibits protein phosphatase-2A and protein phosphatase-1

Alternate Names

chromosome 7 open reading frame 16, GSBSG-substrate

Gene Symbol

PPP1R17

Additional G-substrate Products

Product Documents for G-substrate Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for G-substrate Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G-substrate Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G-substrate Antibody - BSA Free and earn rewards!

Have you used G-substrate Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies