GABA-A R gamma 1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03553

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GABA-A R gamma 1 (NP_775807.2). HSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GABA-A R gamma 1 Antibody - Azide and BSA Free

Western Blot: GABA-A R gamma 1 AntibodyAzide and BSA Free [NBP3-03553]

Western Blot: GABA-A R gamma 1 AntibodyAzide and BSA Free [NBP3-03553]

Western Blot: GABA-A R gamma 1 Antibody [NBP3-03553] - Analysis of extracts of various cell lines, using GABA-A R gamma 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: GABA-A R gamma 1 Antibody - Azide and BSA Free [NBP3-03553]

Immunocytochemistry/ Immunofluorescence: GABA-A R gamma 1 Antibody - Azide and BSA Free [NBP3-03553]

Immunocytochemistry/Immunofluorescence: GABA-A R gamma 1 Antibody [NBP3-03553] - Immunofluorescence analysis of C6 cells using GABA-A R gamma 1 Rabbit pAb (NBP3-03553) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for GABA-A R gamma 1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GABA-A R gamma 1

GABA A Receptor gamma 1 is encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4. [provided by RefSeq]

Long Name

gamma-Aminobutyric Acid Type A Receptor, gamma-1 Polypeptide

Alternate Names

GABAAR gamma 1, GABAARg1, GABRG1, Gamma-1 Polypeptide

Gene Symbol

GABRG1

Additional GABA-A R gamma 1 Products

Product Documents for GABA-A R gamma 1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GABA-A R gamma 1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Customer Reviews for GABA-A R gamma 1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review GABA-A R gamma 1 Antibody - Azide and BSA Free and earn rewards!

Have you used GABA-A R gamma 1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...