GALNT12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14035

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GALNT12 Antibody - BSA Free

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035]

Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining in human epididymis and fallopian tube tissues using anti-GALNT12 antibody. Corresponding GALNT12 RNA-seq data are presented for the same tissues.

Applications for GALNT12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 12/GALNT12

GALNT12, also known as Polypeptide N-acetylgalactosaminyltransferase 12, has a 581 amino acid long isoform that is 67 kDa and a short 272 amino acid isoform that is 32 kDa, plays role in catalyzing the initial reaction in O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; displays activity toward non-glycosylated peptides such as Muc5AC, Muc1a and EA2, Gal-NAc-Muc5AC glycopeptide; and initializes mucin-type oligosaccharide biosynthesis in digestive organs. Studies on this protein have shown a relationship with the following disorders and diseases: colorectal cancer, colon cancer, cerebritis, thyroiditis, and prostatitis. This protein has also been shown to have interactions with MUC7, MUC1, MUC2, MUC5AC, and C1GALT1 in the pathways such as the O-linked glycosylation of mucins, metabolism of proteins, post-translational protein modification, and mucin type O-Glycan biosynthesis.

Long Name

UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12

Alternate Names

CRCS1, GalNAc-T12, Pp-GaNTase 12

Gene Symbol

GALNT12

Additional Polypeptide GalNAc Transferase 12/GALNT12 Products

Product Documents for GALNT12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GALNT12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GALNT12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GALNT12 Antibody - BSA Free and earn rewards!

Have you used GALNT12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...