gamma Adducin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79784

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all gamma Adducin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human ADD3. Peptide sequence AYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for gamma Adducin Antibody - BSA Free

Western Blot: gamma Adducin Antibody [NBP1-79784]

Western Blot: gamma Adducin Antibody [NBP1-79784]

Western Blot: gamma Adducin Antibody [NBP1-79784] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.
Immunocytochemistry/ Immunofluorescence: gamma Adducin Antibody [NBP1-79784]

Immunocytochemistry/ Immunofluorescence: gamma Adducin Antibody [NBP1-79784]

Immunocytochemistry/Immunofluorescence: gamma Adducin Antibody [NBP1-79784] - mouse HEI-OCI auditory cells 10 ug/ml

Applications for gamma Adducin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: gamma Adducin

Adducins are a family of cytoskeleton proteins encoded by three genes (alpha, beta and gamma). Adducin is a protein associated with the inner leaflet of the plasma membrane and is one of the proteins localized at the spectrin-actin junction of the membrane skeleton. The cortical actin cytoskeletal network is lost during apoptosis and adducins are central in the cortical actin network organization. Adducin alpha is a cytoskeletal protein involved with sodium-pump activity in the renal tubule and is associated with hypertension. The expression of Adducin alpha and Adducin gamma is ubiquitous in contrast to the restricted expression of Adducin beta. Adducin beta is expressed at high levels in brain and hematopoietic tissues, such as bone marrow in humans, and spleen in mice.

Alternate Names

ADDLAdducin-like protein 70, adducin 3 (gamma), gamma-adducin

Gene Symbol

ADD3

UniProt

NP_058432 (Human)

Additional gamma Adducin Products

Product Documents for gamma Adducin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for gamma Adducin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for gamma Adducin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review gamma Adducin Antibody - BSA Free and earn rewards!

Have you used gamma Adducin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies